PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.5G003100.1.p
Common NameLOC101780416, SETIT_001336mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family G2-like
Protein Properties Length: 466aa    MW: 49452.1 Da    PI: 6.398
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.5G003100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like89.13.9e-28181235156
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                         k +++WtpeLH+rFv+aveqL G++kA+P++ile+m+++gLt+++++SHLQkYR++
  Seita.5G003100.1.p 181 KVKVDWTPELHRRFVQAVEQL-GIDKAVPSRILEIMGIEGLTRHNIASHLQKYRSH 235
                         5689*****************.********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.389178237IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.4E-27179238IPR009057Homeodomain-like
SuperFamilySSF466892.33E-18180238IPR009057Homeodomain-like
TIGRFAMsTIGR015571.4E-26181235IPR006447Myb domain, plants
PfamPF002491.5E-8184233IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 466 aa     Download sequence    Send to blast
MLEVSSLRSP SKAADQRGFV GDHVGFPTSA GTDDFMVDDN LLDYIDFSSC CDMPFFDADG  60
DILPDLEVDP TESLLAEFSS PETSPAAADG GGGAEAKPPD EKQEQVAAKT AAAEETKADD  120
DEKAAAGGVV VTRKRNGDEV TTTEEDSAGA GAGSDTKSSA AAGGHSKKKA SAGKDSNGKR  180
KVKVDWTPEL HRRFVQAVEQ LGIDKAVPSR ILEIMGIEGL TRHNIASHLQ KYRSHRKHLM  240
AREAEAATWA QKRQLYAAAP VARKVEAAAA AGPPWVVPTI GFPPPPPPAM APPPPPFCRP  300
LHVWGHPPTA AVEAPATMLP VWPRHLAPPR PWVDPGYWHQ QYNAGRTKWA PPQAAAAVTQ  360
GTPCVPPPPA MVQLPRFPHP MYSRPPVMVP PPPPPPTTTT TKLAELQLQL DAHPSKESID  420
AAIGDVLVKP WLPLPLGLKP PSLDSVMSEL HKQGIPKIPP ASSTG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A3e-15178233257ARR10-B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF3185791e-100AF318579.1 Zea mays putative transcription factor GOLDEN 2 mRNA, complete cds.
GenBankBT0628381e-100BT062838.1 Zea mays full-length cDNA clone ZM_BFb0374G22 mRNA, complete cds.
GenBankEU9567921e-100EU956792.1 Zea mays clone 1574106 transcription factor ZmGLK1 mRNA, complete cds.
GenBankKJ7276891e-100KJ727689.1 Zea mays clone pUT5628 G2-like transcription factor (GLK13) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004967344.10.0PREDICTED: probable transcription factor GLK2
SwissprotQ5NAN51e-118GLK2_ORYSJ; Probable transcription factor GLK2
TrEMBLK3XHG50.0K3XHG5_SETIT; Uncharacterized protein
STRINGSi001336m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP24153886
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G20570.17e-54GBF's pro-rich region-interacting factor 1